============================ BLASTing your assembled data ============================ One thing everyone wants to do is BLAST sequence data, right? Here's a simple way to set up a stylish little BLAST server that lets you search your newly assembled sequences. Installing blastkit ------------------- Installing some prerequisites:: pip install pygr pip install whoosh pip install git+https://github.com/ctb/pygr-draw.git pip install git+https://github.com/ged-lab/screed.git apt-get -y install lighttpd and configure them:: cd /etc/lighttpd/conf-enabled ln -fs ../conf-available/10-cgi.conf ./ echo 'cgi.assign = ( ".cgi" => "" )' >> 10-cgi.conf echo 'index-file.names += ( "index.cgi" ) ' >> 10-cgi.conf /etc/init.d/lighttpd restart Next, install BLAST:: cd /root curl -O ftp://ftp.ncbi.nih.gov/blast/executables/release/2.2.24/blast-2.2.24-x64-linux.tar.gz tar xzf blast-2.2.24-x64-linux.tar.gz cp blast-2.2.24/bin/* /usr/local/bin cp -r blast-2.2.24/data /usr/local/blast-data And put in blastkit:: cd /root git clone https://github.com/ctb/blastkit.git -b ec2 cd blastkit/www ln -fs $PWD /var/www/blastkit mkdir files chmod a+rxwt files chmod +x /root and run check.py:: cd /root/blastkit python ./check.py It should say everything is OK. Adding the data --------------- If you've just finished annotating a metagenome assembly (:doc:`6-annotating`) then you can do this to copy your newly generated assembly into the right place:: cp /mnt/annot/metag/testasm.faa /root/blastkit/db/db-prot.fa Alternatively, you can grab our version of the assembly (from running this tutorial):: cd /root/blastkit curl -O http://athyra.idyll.org/~t/testasm.faa mv testasm.faa db/db-prot.fa Formatting the database ~~~~~~~~~~~~~~~~~~~~~~~ After you've done either of the above, format and install the database for blastkit:: cd /root/blastkit formatdb -i db/db-prot.fa -o T -p T python index-db.py db/db-prot.fa Done! .. note:: You can install any file of protein sequences you want this way; just copy it into /root/blastkit/db/db-prot.fa and run the indexing commands, above. Running blastkit ---------------- Figure out what your machine name is (ec2-???-???-???-???.compute-1.amazonaws.com) and go to:: http://machine-name/blastkit/ Make sure you have enabled port 80 in your security settings on Amazon. (If you're using the human data set, try this sequence:: MYLYTSYGTYQFLNQIKLNHQERNLFQFSTNDSSIILEESEGKSILKHPSSYQVIDSTGE FNEHHFYSAIFVPTSEDHRQQLEKKLLHVDVPLSNFGGFKSYRLLKPTEGSTYKIYFGFA NRTAYEDFKASDIFNENFSKDALSQYFGASGQHSSYFERYLYPIEDH It should match something in your assembly.)